Cagrilintide 5mg

Compound Overview

Cagrilintide 5mg is a lyophilized synthetic peptide preparation supplied by Amino Apex for qualified laboratory research. Cagrilintide, also known as AM833, is a lipidated, long-acting analogue of the naturally occurring pancreatic hormone amylin. Its molecular structure incorporates modifications designed to influence peptide stability, receptor interactions, and duration of biological activity. Experimental pharmacological research has characterized cagrilintide as an agonist of amylin receptors (AMYRs) and the calcitonin receptor (CTR). Amylin receptors consist of the calcitonin receptor associated with receptor activity-modifying proteins (RAMP1, RAMP2, or RAMP3), forming the AMY1R, AMY2R, and AMY3R receptor subtypes. These receptor systems are investigated in relation to G protein-coupled receptor signaling, peptide-receptor interactions, and neuroendocrine regulation. A 2021 peer-reviewed study published in the Journal of Pharmacology and Experimental Therapeutics investigated the pharmacological characteristics of cagrilintide across amylin and calcitonin receptor systems. Researchers examined receptor binding, activation, and regulatory responses, identifying a distinct pharmacological profile compared with other calcitonin-family receptor agonists. Additional structural research has investigated how cagrilintide interacts with these receptor complexes. A 2025 peer-reviewed study published in Nature Communications used cryo-electron microscopy to characterize cagrilintide binding to AMY1R, AMY2R, AMY3R, and CTR, examining receptor conformational dynamics and molecular interactions. These publications provide scientific background and do not establish therapeutic effectiveness or safety for the Amino Apex research material.

Molecular & Structural Research

Cagrilintide contains a 37-residue amylin-derived peptide backbone with the sequence:

KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂

The peptide is C-terminally amidated and contains a disulfide bridge between cysteine residues 2 and 7. Structural studies also identify a lipid modification associated with the N-terminal lysine region, a feature involved in the long-acting design of the molecule.

Compared with human amylin, cagrilintide incorporates several sequence substitutions, including residues designed to modify chemical stability, fibrillation behavior, and receptor interactions. Structural research has identified distinctive interactions involving residues such as Glu14, Arg17, Phe23, and Pro37 during receptor engagement.

Its reported molecular formula is:

C₁₉₄H₃₁₂N₅₄O₅₉S₂

with a molecular weight of approximately:

4,409 g/mol

Cagrilintide is associated with CAS Number 1415456-99-3.

Research Applications

Cagrilintide may be studied in appropriately designed laboratory research involving:

• Amylin receptor signaling
• AMY₁R, AMY₂R, and AMY₃R pharmacology
• Calcitonin receptor signaling
• GPCR activation and Gs signaling
• Peptide-receptor binding studies
• RAMP-associated receptor biology
• Neuroendocrine signaling
• Amylin-associated metabolic pathways
• Peptide structure-function relationships
• Lipidated peptide research
• Peptide stability and aggregation research
• Receptor conformational dynamics
• Comparative amylin analogue research
• Analytical peptide characterization

Cryo-EM studies have directly characterized cagrilintide bound to multiple amylin receptor subtypes and CTR, making it particularly relevant to structural and mechanistic studies of calcitonin-family receptors.

These categories describe areas of scientific investigation and do not constitute therapeutic or clinical-use recommendations.

Preclinical Research Context

Cagrilintide has been investigated in biochemical systems, receptor-expression models, animal studies, and human clinical research.

Preclinical work has examined its activity at amylin and calcitonin receptors, while structural studies have characterized how the peptide interacts with receptor extracellular and transmembrane regions and activates Gs-associated signaling.

Cagrilintide has also been studied clinically as a long-acting amylin analogue, but laboratory product information should distinguish those published investigations from the characteristics of an individual research-material lot.

Experimental findings should be interpreted within the specific model, assay conditions, receptor system, and limitations of each study and should not be assumed to establish effects for the Amino Apex research material.

Analytical Documentation

Amino Apex provides batch-specific analytical documentation for tested lots. Individual lot documentation may include chromatographic purity analysis and other analytical information associated with the tested sample.

Because analytical characteristics may differ by production lot, the Certificate of Analysis for the applicable batch should be used as the source of measured purity and quality-control results.

Refer to the COA panel on this page or the Amino Apex COA Library for available batch documentation.

Storage & Laboratory Handling

This material should be handled only by qualified personnel using procedures appropriate for laboratory peptide materials.

Storage and handling should follow the conditions specified in the applicable product and batch documentation.

Experimental preparation, concentration, assay conditions, and analytical methodology should be established by qualified researchers according to the requirements of their specific laboratory system.

Research Use Only

For laboratory research use only.

This material is not intended for human or animal use. It is not intended for diagnostic, therapeutic, food, cosmetic, or household applications and is not intended to diagnose, treat, cure, prevent, or mitigate any disease or medical condition.