Tesamorelin 10mg

Compound Overview

Tesamorelin 10mg is a lyophilized peptide preparation supplied by Amino Apex for laboratory research applications. Tesamorelin is a synthetic 44-amino-acid analogue of human growth hormone-releasing hormone (GHRH 1–44). It has been investigated in biochemical, cellular, and clinical research involving GHRH-receptor activation, pituitary signaling, endogenous growth-hormone regulation, and downstream IGF-1-associated pathways.

Tesamorelin interacts with the growth hormone-releasing hormone receptor (GHRHR). Activation of this receptor in pituitary somatotroph cells stimulates pathways involved in the synthesis and pulsatile release of endogenous growth hormone. Growth-hormone signaling subsequently influences IGF-1 and IGFBP-3-associated endocrine pathways.

A distinguishing feature of Tesamorelin is its N-terminal structural modification, which was developed to provide greater stability than native GHRH while maintaining GHRH-receptor activity.

Molecular & Structural Research

Tesamorelin consists of 44 amino-acid residues with the peptide sequence:

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Its molecular formula is C₂₂₁H₃₆₆N₇₂O₆₇S, with an approximate molecular weight of 5,136 g/mol. The parent Tesamorelin compound is associated with CAS 218949-48-5.

The peptide is derived from the human GHRH 1–44 sequence and incorporates a trans-3-hexenoyl group at the N-terminus. This structural modification has been investigated for its contribution to enhanced peptide stability relative to endogenous GHRH.

Experimental research has characterized Tesamorelin as an agonist of the human GHRH receptor, providing a model for studying receptor-mediated endocrine signaling and growth-hormone secretory dynamics.

Research Applications

Tesamorelin may be studied in appropriately designed laboratory research involving:

• GHRH-receptor signaling
• Pituitary somatotroph signaling
• Growth-hormone secretory pathways
• Pulsatile hormone-release research
• IGF-1-associated signaling
• IGFBP-3-associated pathways
• Hypothalamic-pituitary signaling research
• Endocrine feedback mechanisms
• Peptide-receptor interaction studies
• GHRH analogue characterization
• Peptide stability research
• Structure-function studies
• Comparative endocrine peptide research
• Analytical peptide characterization

Preclinical Research Context

Tesamorelin has been examined in in-vitro, preclinical, and human research settings investigating GHRH-receptor pharmacology, endogenous growth-hormone pulsatility, IGF-1 signaling, endocrine physiology, and metabolic pathways.

Experimental studies have also investigated the relationship between its N-terminal modification and resistance to enzymatic degradation, including enhanced stability relative to native GHRH.

For an RUO product page, published biological findings should be presented as research context rather than statements of therapeutic effect or recommendations for use.

Additional information about Tesamorelin's receptor activity and endocrine signaling is available in the FDA's published clinical pharmacology documentation.

Analytical Documentation

Amino Apex provides batch-specific analytical documentation for Tesamorelin 10mg research material, including available laboratory testing records for individual production lots.

Because analytical characteristics may differ by production lot, the Certificate of Analysis for the applicable batch should be used as the source of measured purity and quality-control results.

Refer to the COA panel on this page or the Amino Apex COA Library for available batch documentation.

Storage & Laboratory Handling

This material should be handled only by qualified personnel using procedures appropriate for laboratory peptide materials.

Storage and handling should follow the conditions specified in the applicable product and batch documentation.

Experimental preparation, concentration, assay conditions, and analytical methodology should be established by qualified researchers according to the requirements of their specific laboratory system.

Research Use Only

For laboratory research use only.

This material is not intended for human or animal use. It is not intended for diagnostic, therapeutic, food, cosmetic, or household applications and is not intended to diagnose, treat, cure, prevent, or mitigate any disease or medical condition.