TB-500 10mg

Compound Overview

TB-500 10mg is a research peptide preparation supplied by Amino Apex for qualified laboratory research. The product is currently described as Thymosin Beta-4 (TB-4), a 43-amino-acid peptide studied in laboratory research involving actin dynamics, cytoskeletal organization, cellular migration, endothelial responses, and cellular motility.

Thymosin Beta-4 is recognized for its interaction with G-actin, making it relevant to experimental investigations involving actin sequestration, cytoskeletal regulation, cell movement, and intracellular organization.

Published research has examined TB-4 across a range of biochemical, cellular, and preclinical research models to characterize its molecular behavior and associated cellular pathways.

Published scientific research involving Thymosin Beta-4 (TB-4) and related TB-500 peptides has examined actin regulation, cytoskeletal organization, cellular migration, endothelial signaling, and tissue-response pathways. A broader assessment of the available scientific evidence is presented in the 2026 scientific review of Thymosin Beta-4 and TB-500 research published in Applied Sciences. The review discusses experimental findings, differences between related peptide compounds, and limitations of available human clinical evidence. Additional mechanistic research has investigated the relationship between Thymosin Beta-4, actin binding, endothelial cell migration, and angiogenesis. These findings are discussed in the 2003 Thymosin Beta-4 actin-binding and angiogenesis study published in The FASEB Journal. This research concerns experimental biological mechanisms and does not establish therapeutic effectiveness in humans.

Molecular & Structural Research

Thymosin Beta-4 consists of 43 amino-acid residues with the sequence:

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Its molecular formula is C₂₁₂H₃₅₀N₅₆O₇₈S, with an approximate molecular mass of 4,963 g/mol.

A key structural feature of Thymosin Beta-4 is its actin-binding region containing the LKKTET sequence. This region has been investigated in relation to G-actin binding, actin polymerization, cytoskeletal dynamics, and cellular migration.

These structural characteristics make TB-4 relevant to experimental research involving peptide-protein interactions and actin-dependent cellular processes.

Research Applications

TB-4 may be studied in appropriately designed laboratory research involving:

• Actin-binding research
• G-actin sequestration studies
• Cytoskeletal organization
• Cell migration and motility
• Endothelial cell-response studies
• Angiogenesis-associated signaling
• Fibroblast-response research
• Extracellular-matrix investigations
• Cellular stress-response studies
• Peptide-protein interaction research
• Comparative thymosin research
• Analytical peptide characterization

These categories describe areas of scientific investigation and do not constitute therapeutic or clinical-use recommendations.

Preclinical Research Context

Published research involving Thymosin Beta-4 includes cellular, biochemical, and animal-model investigations examining its relationship with actin regulation, cellular migration, endothelial behavior, cytoskeletal organization, and other cellular-response pathways.

Much of the available research remains preclinical, meaning observations obtained from experimental systems should not be assumed to establish clinical safety, efficacy, or therapeutic effects in humans.

Ongoing research continues to investigate the molecular mechanisms and signaling pathways associated with Thymosin Beta-4.

Analytical Documentation

Amino Apex provides batch-specific analytical documentation for tested lots. Individual lot documentation may include chromatographic purity analysis and other analytical information associated with the tested sample.

Because analytical characteristics may differ by production lot, the Certificate of Analysis for the applicable batch should be used as the source of measured purity and quality-control results.

Refer to the COA panel on this page or the Amino Apex COA Library for available batch documentation.

Storage & Laboratory Handling

This material should be handled only by qualified personnel using procedures appropriate for laboratory peptide materials.

Storage and handling should follow the conditions specified in the applicable product and batch documentation.

Experimental preparation, concentration, assay conditions, and analytical methodology should be established by qualified researchers according to the requirements of their specific laboratory system.

Research Use Only

For laboratory research use only.

This material is not intended for human or animal use. It is not intended for diagnostic, therapeutic, food, cosmetic, or household applications and is not intended to diagnose, treat, cure, prevent, or mitigate any disease or medical condition.